Lineage for d6ocri_ (6ocr I:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (47 PDB entries)
  8. 3067509Domain d6ocri_: 6ocr I: [367571]
    automated match to d3drza_

Details for d6ocri_

PDB Entry: 6ocr (more details), 2.28 Å

PDB Description: crystal structure of human kctd16 t1 domain
PDB Compounds: (I:) btb/poz domain-containing protein kctd16

SCOPe Domain Sequences for d6ocri_:

Sequence, based on SEQRES records: (download)

>d6ocri_ d.42.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgflf
ryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp

Sequence, based on observed residues (ATOM records): (download)

>d6ocri_ d.42.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpevvelnvggqvyftrhstlisiphsllwkmfsakdskgrffidrdgflfryildylrd
rqvvlpdhfpekgrlkreaeyfqlpdlvklltp

SCOPe Domain Coordinates for d6ocri_:

Click to download the PDB-style file with coordinates for d6ocri_.
(The format of our PDB-style files is described here.)

Timeline for d6ocri_:

  • d6ocri_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-11