SCOPe 2.08: Domain d6o44b1: 6o44 B:1-275

Lineage for d6o44b1 (6o44 B:1-275)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein automated matches [190073] (16 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187756] (2 PDB entries)

8. Domain d6o44b1: 6o44 B:1-275 [367536]
   Other proteins in same PDB: d6o44a2, d6o44b2
   automated match to d1scja_
   complexed with ca, edo, so4

Details for d6o44b1

PDB Entry: 6o44, 1.83 Å

PDB Description: insight into subtilisin e-s7 cleavage pattern based on crystal structure and hydrolysates peptide analysis

PDB Compounds: (B:) Nattokinase

SCOPe Domain Sequences for d6o44b1:

Sequence; same for both SEQRES and ATOM records:

>d6o44b1 c.41.1.1 (B:1-275) automated matches {Bacillus subtilis [TaxId: 1423]}
aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
vinmslggpsgstalktvvdkavssgivvaaaagnegssgssstvgypakypstiavgav
nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt
wtnaqvrdrlestatylgnsfyygkglinvqaaaq

Timeline for d6o44b1:

• d6o44b1 first appeared in SCOPe 2.07