SCOPe 2.08: Domain d6ilwa1: 6ilw A:29-290

Lineage for d6ilwa1 (6ilw A:29-290)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Ideonella sakaiensis [TaxId:1547922] [343272] (26 PDB entries)

8. Domain d6ilwa1: 6ilw A:29-290 [367476]
   Other proteins in same PDB: d6ilwa2
   automated match to d1jfra_
   complexed with cl, na

Details for d6ilwa1

PDB Entry: 6ilw, 1.58 Å

PDB Description: crystal structure of petase from ideonella sakaiensis

PDB Compounds: (A:) Poly(ethylene terephthalate) hydrolase

SCOPe Domain Sequences for d6ilwa1:

Sequence; same for both SEQRES and ATOM records:

>d6ilwa1 c.69.1.0 (A:29-290) automated matches {Ideonella sakaiensis [TaxId: 1547922]}
tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
stfacenpnstrvsdfrtancs

Timeline for d6ilwa1:

• d6ilwa1 first appeared in SCOPe 2.07