Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries) |
Domain d6ijha1: 6ijh A:449-768 [367474] Other proteins in same PDB: d6ijha2, d6ijhb2 automated match to d4ajmd_ complexed with aeo, mg, zn |
PDB Entry: 6ijh (more details), 2.6 Å
SCOPe Domain Sequences for d6ijha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ijha1 a.211.1.0 (A:449-768) automated matches {Human (Homo sapiens) [TaxId: 9606]} sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt epllkacrdnlsqwekvirg
Timeline for d6ijha1: