Lineage for d6g2za_ (6g2z A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452278Species Human (Homo sapiens) [TaxId:9606] [186862] (155 PDB entries)
  8. 3067391Domain d6g2za_: 6g2z A: [367453]
    automated match to d3b9pa_
    complexed with adp, dms, ejw, mpd, na

Details for d6g2za_

PDB Entry: 6g2z (more details), 1.92 Å

PDB Description: crystal structure of the p97 d2 domain in a helical split-washer conformation
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d6g2za_:

Sequence, based on SEQRES records: (download)

>d6g2za_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvevpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktll
akaianecqanfisikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarg
gnigdgggaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyipl
pdeksrvailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesiesei
rrererqtnpsameveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlq

Sequence, based on observed residues (ATOM records): (download)

>d6g2za_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvevpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktll
akaianecqanfisikgpelltseanvreifdkarqaapcvlffdeldsiakaadrvinq
iltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrk
spvakdvdleflakmtngfsgadlteicqracklairesieseirrerepvpeirrdhfe
eamrfarrsvsdndirkyemfaqtlq

SCOPe Domain Coordinates for d6g2za_:

Click to download the PDB-style file with coordinates for d6g2za_.
(The format of our PDB-style files is described here.)

Timeline for d6g2za_:

  • d6g2za_ appears in periodic updates to SCOPe 2.07 starting on 2019-04-11