Lineage for d6hsvb_ (6hsv B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788204Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2788746Protein automated matches [190381] (11 species)
    not a true protein
  7. 2788934Species Vibrio cholerae [TaxId:666] [311230] (2 PDB entries)
  8. 2788944Domain d6hsvb_: 6hsv B: [367436]
    automated match to d5elea_
    complexed with cl, mpd, po4

Details for d6hsvb_

PDB Entry: 6hsv (more details), 2.45 Å

PDB Description: engineered higher-order assembly of cholera toxin b subunits via the addition of c-terminal parallel coiled-coiled domains
PDB Compounds: (B:) Toxin B subunit

SCOPe Domain Sequences for d6hsvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hsvb_ b.40.2.1 (B:) automated matches {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d6hsvb_:

Click to download the PDB-style file with coordinates for d6hsvb_.
(The format of our PDB-style files is described here.)

Timeline for d6hsvb_: