SCOPe 2.08: Domain d6enga1: 6eng A:12-220

Lineage for d6enga1 (6eng A:12-220)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [271298] (26 PDB entries)

8. Domain d6enga1: 6eng A:12-220 [367389]
   Other proteins in same PDB: d6enga2
   automated match to d4prxa1
   complexed with bhw, cl, k, na, pg4, po4

Details for d6enga1

PDB Entry: 6eng, 2.3 Å

PDB Description: crystal structure of the 43k atpase domain of escherichia coli gyrase b in complex with an aminocoumarin

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6enga1:

Sequence; same for both SEQRES and ATOM records:

>d6enga1 d.122.1.0 (A:12-220) automated matches {Escherichia coli [TaxId: 83333]}
vlkgldavrkrpgmyigdtddgtglhhmvfevvdnaidealaghckeiivtihadnsvsv
qddgrgiptgihpeegvsaaevimtvlhaggkfddnsykvsgglhgvgvsvvnalsqkle
lviqregkihrqiyehgvpqaplavtgetektgtmvrfwpsletftnvtefeyeilakrl
relsflnsgvsirlrdkrdgkedhfhyeg

Timeline for d6enga1:

• d6enga1 first appeared in SCOPe 2.07