SCOPe 2.07: Domain d6g1eb1: 6g1e B:237-339

Lineage for d6g1eb1 (6g1e B:237-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6g1eb1: 6g1e B:237-339 [367378]
   Other proteins in same PDB: d6g1ea1, d6g1ea2
   automated match to d1hzhh3
   complexed with bma, ful, gal, man, nag

Details for d6g1eb1

PDB Entry: 6g1e, 1.88 Å

PDB Description: beat fc with improved heterodimerization (q3a-d84.4q)

PDB Compounds: (B:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d6g1eb1:

Sequence; same for both SEQRES and ATOM records:

>d6g1eb1 b.1.1.2 (B:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Timeline for d6g1eb1:

• d6g1eb1 is new in SCOPe 2.07-stable
  
• d6g1eb1 appears in the current release, SCOPe 2.08