Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
Protein Proapoptotic molecule Bax [56862] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [56863] (7 PDB entries) |
Domain d6eb6a_: 6eb6 A: [367342] automated match to d2k7wa_ complexed with fmt |
PDB Entry: 6eb6 (more details), 2.02 Å
SCOPe Domain Sequences for d6eb6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6eb6a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]} ptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseclkrigdelds nmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpel irtimgatldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagvltasltiwkkm
Timeline for d6eb6a_: