Lineage for d6eb6a_ (6eb6 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021466Protein Proapoptotic molecule Bax [56862] (3 species)
  7. 3021467Species Human (Homo sapiens) [TaxId:9606] [56863] (7 PDB entries)
  8. 3021471Domain d6eb6a_: 6eb6 A: [367342]
    automated match to d2k7wa_
    complexed with fmt

Details for d6eb6a_

PDB Entry: 6eb6 (more details), 2.02 Å

PDB Description: crystal structure of bax w139a monomer
PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d6eb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eb6a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Human (Homo sapiens) [TaxId: 9606]}
ptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseclkrigdelds
nmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalctkvpel
irtimgatldflrerllgwiqdqggwdgllsyfgtptwqtvtifvagvltasltiwkkm

SCOPe Domain Coordinates for d6eb6a_:

Click to download the PDB-style file with coordinates for d6eb6a_.
(The format of our PDB-style files is described here.)

Timeline for d6eb6a_: