Lineage for d6cxad1 (6cxa D:2-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 3067264Domain d6cxad1: 6cxa D:2-112 [367326]
    Other proteins in same PDB: d6cxaa1, d6cxab_, d6cxac2
    automated match to d3q5ya1
    complexed with bma, emg, fuc, man, na, nag

Details for d6cxad1

PDB Entry: 6cxa (more details), 2.65 Å

PDB Description: structure of alpha-gsa[20,6p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (D:) Chimeric T cell antigen receptor beta chain Vb8.2, vb11

SCOPe Domain Sequences for d6cxad1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cxad1 b.1.1.0 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d6cxad1:

Click to download the PDB-style file with coordinates for d6cxad1.
(The format of our PDB-style files is described here.)

Timeline for d6cxad1:

  • d6cxad1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11