Lineage for d6cx7d2 (6cx7 D:113-240)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 3067260Domain d6cx7d2: 6cx7 D:113-240 [367322]
    Other proteins in same PDB: d6cx7a1, d6cx7b_, d6cx7c2
    automated match to d3q5ya2
    complexed with elm, fuc, na, nag, plm

Details for d6cx7d2

PDB Entry: 6cx7 (more details), 2.6 Å

PDB Description: structure of alpha-gsa[12,6p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (D:) Chimeric T cell antigen receptor beta chain Vb8.2, vb11

SCOPe Domain Sequences for d6cx7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cx7d2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d6cx7d2:

Click to download the PDB-style file with coordinates for d6cx7d2.
(The format of our PDB-style files is described here.)

Timeline for d6cx7d2:

  • d6cx7d2 appears in periodic updates to SCOPe 2.07 starting on 2019-04-11