Lineage for d6o9pa2 (6o9p A:237-563)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (41 species)
    not a true protein
  7. 3067198Species Santalum album [TaxId:35974] [367260] (2 PDB entries)
  8. 3067203Domain d6o9pa2: 6o9p A:237-563 [367265]
    Other proteins in same PDB: d6o9pa1
    automated match to d2onha2
    complexed with bfq, edo, mg

Details for d6o9pa2

PDB Entry: 6o9p (more details), 2.1 Å

PDB Description: wild-type sasqs1 complexed with ibandronate
PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6o9pa2:

Sequence, based on SEQRES records: (download)

>d6o9pa2 a.128.1.0 (A:237-563) automated matches {Santalum album [TaxId: 35974]}
mnptllkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfep
hlgevremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmpllt
mfntsndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvs
igfpnllvtsylltvdnptkekldyvdslplfvrascilcriindlgtspdemergdnlk
siqcymnetgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffy
qygdgygnaeswtknqgmsvlihpitl

Sequence, based on observed residues (ATOM records): (download)

>d6o9pa2 a.128.1.0 (A:237-563) automated matches {Santalum album [TaxId: 35974]}
mnptllkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfep
hlgevremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmpllt
mfntsndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvs
igfpnllvtsylltvdnptkekldyvdslplfvrascilcriindlgtrgdnlksiqcym
netgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffyqswtkn
qgmsvlihpitl

SCOPe Domain Coordinates for d6o9pa2:

Click to download the PDB-style file with coordinates for d6o9pa2.
(The format of our PDB-style files is described here.)

Timeline for d6o9pa2:

  • d6o9pa2 appears in periodic updates to SCOPe 2.07 starting on 2019-04-04

View in 3D
Domains from same chain:
(mouse over for more information)
d6o9pa1