Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Santalum album [TaxId:35974] [367260] (11 PDB entries) |
Domain d6o9pa2: 6o9p A:237-563 [367265] Other proteins in same PDB: d6o9pa1 automated match to d2onha2 complexed with bfq, edo, mg |
PDB Entry: 6o9p (more details), 2.1 Å
SCOPe Domain Sequences for d6o9pa2:
Sequence, based on SEQRES records: (download)
>d6o9pa2 a.128.1.0 (A:237-563) automated matches {Santalum album [TaxId: 35974]} mnptllkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfep hlgevremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmpllt mfntsndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvs igfpnllvtsylltvdnptkekldyvdslplfvrascilcriindlgtspdemergdnlk siqcymnetgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffy qygdgygnaeswtknqgmsvlihpitl
>d6o9pa2 a.128.1.0 (A:237-563) automated matches {Santalum album [TaxId: 35974]} mnptllkyakldfnivqsfhqaeigrlarwwvgtgldklpfarngliqsymyaigmlfep hlgevremeakvgalittiddvydvygtmeelelftditerwdinrvdqlprnirmpllt mfntsndigywalkergfngipytakvwadqlksytkeakwfheghkptleeylenalvs igfpnllvtsylltvdnptkekldyvdslplfvrascilcriindlgtrgdnlksiqcym netgasqevarehieglvrmwwkrlnkclfepspftepflsftinvvrgshffyqswtkn qgmsvlihpitl
Timeline for d6o9pa2: