Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6o3aa1: 6o3a A:1-106 [367262] Other proteins in same PDB: d6o3aa2, d6o3ab_, d6o3ae_ automated match to d3pgfl1 complexed with cxs, edo, na, nag |
PDB Entry: 6o3a (more details), 2.1 Å
SCOPe Domain Sequences for d6o3aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o3aa1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps rfsgsrsgtdftltisslqpedfatyycqqyyslftfgqgtkveik
Timeline for d6o3aa1: