Lineage for d6o9qa1 (6o9q A:33-236)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330425Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2330752Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2330753Protein automated matches [226931] (10 species)
    not a true protein
  7. 3067196Species Santalum album [TaxId:35974] [367258] (2 PDB entries)
  8. 3067197Domain d6o9qa1: 6o9q A:33-236 [367259]
    Other proteins in same PDB: d6o9qa2
    automated match to d2onha1
    complexed with act, edo

Details for d6o9qa1

PDB Entry: 6o9q (more details), 1.9 Å

PDB Description: wild-type sasqs1
PDB Compounds: (A:) Sesquisabinene B synthase 1

SCOPe Domain Sequences for d6o9qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o9qa1 a.102.4.0 (A:33-236) automated matches {Santalum album [TaxId: 35974]}
panlwdydflqslgrhssvteehvglaeklkgevkslitgpmeplaklefidsvrrlglk
yqfetemkealaniskdgydswwvdnlratalrfrllrengifvpqdvferfqnketgkf
knelcedvkgllnlyeasflgwegedildeartfstaqlknvegkisspnlakivhhald
lplhwrairyearwfidiyedeed

SCOPe Domain Coordinates for d6o9qa1:

Click to download the PDB-style file with coordinates for d6o9qa1.
(The format of our PDB-style files is described here.)

Timeline for d6o9qa1:

  • d6o9qa1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-04

View in 3D
Domains from same chain:
(mouse over for more information)
d6o9qa2