SCOPe 2.08: Domain d6o7ui2: 6o7u i:82-159

Lineage for d6o7ui2 (6o7u i:82-159)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families)
   automatically mapped to Pfam PF00137

5. Family f.17.1.0: automated matches [367203] (1 protein)
   not a true family

6. Protein automated matches [367204] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [367205] (1 PDB entry)

8. Domain d6o7ui2: 6o7u i:82-159 [367206]
   Other proteins in same PDB: d6o7ud_, d6o7ug1, d6o7uh1, d6o7ui1, d6o7uj1, d6o7uk1, d6o7ul1, d6o7um1, d6o7un1
   automated match to d3j9tr2

Details for d6o7ui2

PDB Entry: 6o7u, 3.1 Å

PDB Description: saccharomyces cerevisiae v-atpase stv1-vo

PDB Compounds: (i:) V-type proton ATPase subunit C

SCOPe Domain Sequences for d6o7ui2:

Sequence; same for both SEQRES and ATOM records:

>d6o7ui2 f.17.1.0 (i:82-159) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qalytgfiqlgaglsvglsglaagfaigivgdagvrgssqqprlfvgmililifaevlgl
yglivalllnsratqdvv

Timeline for d6o7ui2:

• d6o7ui2 first appeared in SCOPe 2.07