Lineage for d6o7ui1 (6o7u i:3-81)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3023861Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) (S)
    automatically mapped to Pfam PF00137
  5. 3023862Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins)
  6. 3023902Protein automated matches [367200] (3 species)
    not a true protein
  7. 3023903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [367201] (1 PDB entry)
  8. 3023906Domain d6o7ui1: 6o7u i:3-81 [367202]
    Other proteins in same PDB: d6o7ud_, d6o7ug2, d6o7uh2, d6o7ui2, d6o7uj2, d6o7uk2, d6o7ul2, d6o7um2, d6o7un2, d6o7uo1, d6o7uo2
    automated match to d3j9tr1

Details for d6o7ui1

PDB Entry: 6o7u (more details), 3.1 Å

PDB Description: saccharomyces cerevisiae v-atpase stv1-vo
PDB Compounds: (i:) V-type proton ATPase subunit C

SCOPe Domain Sequences for d6o7ui1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o7ui1 f.17.1.1 (i:3-81) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elcpvyapffgaigcasaiiftslgaaygtaksgvgicatcvlrpdllfknivpvimagi
iaiyglvvsvlvcyslgqk

SCOPe Domain Coordinates for d6o7ui1:

Click to download the PDB-style file with coordinates for d6o7ui1.
(The format of our PDB-style files is described here.)

Timeline for d6o7ui1: