Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.1: Rotary ATPase ring subunits [81333] (2 families) automatically mapped to Pfam PF00137 |
Family f.17.1.1: F1F0 ATP synthase subunit C or V-type proton ATPase subunit c [81332] (3 proteins) |
Protein automated matches [367200] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [367201] (1 PDB entry) |
Domain d6o7ui1: 6o7u i:3-81 [367202] Other proteins in same PDB: d6o7ud_, d6o7ug2, d6o7uh2, d6o7ui2, d6o7uj2, d6o7uk2, d6o7ul2, d6o7um2, d6o7un2, d6o7uo1, d6o7uo2 automated match to d3j9tr1 |
PDB Entry: 6o7u (more details), 3.1 Å
SCOPe Domain Sequences for d6o7ui1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o7ui1 f.17.1.1 (i:3-81) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} elcpvyapffgaigcasaiiftslgaaygtaksgvgicatcvlrpdllfknivpvimagi iaiyglvvsvlvcyslgqk
Timeline for d6o7ui1: