Lineage for d6o6qb_ (6o6q B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 3067126Species Candida albicans [TaxId:237561] [367188] (3 PDB entries)
  8. 3067127Domain d6o6qb_: 6o6q B: [367189]
    automated match to d4rlka_
    complexed with amp, cl, gol, so4

Details for d6o6qb_

PDB Entry: 6o6q (more details), 2.7 Å

PDB Description: crystal structure of cka1p, a casein kinase 2 alpha ortholog from candida albicans
PDB Compounds: (B:) Casein kinase 2 catalytic subunit

SCOPe Domain Sequences for d6o6qb_:

Sequence, based on SEQRES records: (download)

>d6o6qb_ d.144.1.7 (B:) automated matches {Candida albicans [TaxId: 237561]}
rhntvqsvsrvyadvlstkpqsywdyddlnikwnpqenyeilrklgrgkysevflgidle
krekvvikvlkpvkrkkikreisilknlvdgpniiamldvvrepqsktpglifehinnid
frslyptftdydirfymyellkaldyshsmgimhrdvkphnvmidhdkkllrlidwglae
yyhpgteynvrvasryfkgpellvdyrlydysldmwsfgcmlasmvfmkepffhgksntd
qlvqivrvlgsknfkkylekynislgeeyedigyynkrqwvrfmnennkdlvsqefldli
drllrydhqerltakeamkhayfdpirva

Sequence, based on observed residues (ATOM records): (download)

>d6o6qb_ d.144.1.7 (B:) automated matches {Candida albicans [TaxId: 237561]}
rhntvqsvsrvyadvlstkpqsywdyddlnikwnpqenyeilrklgrgkysevflgidle
krekvvikvlkpvkrkkikreisilknlvdgpniiamldvvrktpglifehinnidfrsl
yptftdydirfymyellkaldyshsmgimhrdvkphnvmidhdkkllrlidwglaeyyhp
gteynvrvasryfkgpellvdyrlydysldmwsfgcmlasmvfmkepffhgksntdqlvq
ivrvlgsknfkkylekynislgeeyedigyynkrqwvrfmnennkdlvsqefldlidrll
rydhqerltakeamkhayfdpirva

SCOPe Domain Coordinates for d6o6qb_:

Click to download the PDB-style file with coordinates for d6o6qb_.
(The format of our PDB-style files is described here.)

Timeline for d6o6qb_: