Lineage for d6jnpc_ (6jnp C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3005913Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 3005990Family d.198.1.0: automated matches [191351] (1 protein)
    not a true family
  6. 3005991Protein automated matches [190293] (3 species)
    not a true protein
  7. 3005992Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [236548] (2 PDB entries)
  8. 3005996Domain d6jnpc_: 6jnp C: [367187]
    automated match to d4jmfb_
    complexed with gol

Details for d6jnpc_

PDB Entry: 6jnp (more details), 2.26 Å

PDB Description: structure of exot-spcs complex from pseudomonas aeruginosa in 2.2 angstrom
PDB Compounds: (C:) CesT family type III secretion system chaperone

SCOPe Domain Sequences for d6jnpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6jnpc_ d.198.1.0 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mnplyraaihqlflaldlptpndeesvlslqvgphlchlaehptdhllmftrlegqgdat
aneqnlfsqdpckpilgrdpesgerllwnrqplqlldraqihhqleqlvaaaeelr

SCOPe Domain Coordinates for d6jnpc_:

Click to download the PDB-style file with coordinates for d6jnpc_.
(The format of our PDB-style files is described here.)

Timeline for d6jnpc_: