Lineage for d6iwtb2 (6iwt B:121-362)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2469200Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 proteins)
    automatically mapped to Pfam PF00891
  6. 2469240Protein automated matches [226979] (3 species)
    not a true protein
  7. 3067071Species Peucedanum praeruptorum [TaxId:312531] [367133] (1 PDB entry)
  8. 3067072Domain d6iwtb2: 6iwt B:121-362 [367134]
    Other proteins in same PDB: d6iwta1, d6iwtb1
    automated match to d1kyzc2
    complexed with peg

Details for d6iwtb2

PDB Entry: 6iwt (more details), 2.53 Å

PDB Description: crystal structure of methyltransferase comt-s in p. praeruptorum
PDB Compounds: (B:) Pmethyltransferase pCOMT-S

SCOPe Domain Sequences for d6iwtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iwtb2 c.66.1.12 (B:121-362) automated matches {Peucedanum praeruptorum [TaxId: 312531]}
dgvsmaplllmnqdkilmeswyhlkdavldggipfnkaygmtafeyhgkdprfnkvfnlg
msnhstitmkkilqtyngfaglktvvdvgggtgatlnmiiskypnikginfdlphvveda
psypgvehvggdmfvsvpegdaifmkwichdwsdahclsflkncykalpqngkvilaeci
lpeapdsklttknvihidvimlahnpggkertekefealgkmagfksfnkvccahntwim
ef

SCOPe Domain Coordinates for d6iwtb2:

Click to download the PDB-style file with coordinates for d6iwtb2.
(The format of our PDB-style files is described here.)

Timeline for d6iwtb2:

  • d6iwtb2 appears in periodic updates to SCOPe 2.07 starting on 2019-04-04

View in 3D
Domains from same chain:
(mouse over for more information)
d6iwtb1