Lineage for d6iwtb1 (6iwt B:17-120)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307165Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307166Protein automated matches [190154] (78 species)
    not a true protein
  7. 3052541Species Peucedanum praeruptorum [TaxId:312531] [352603] (2 PDB entries)
  8. 3067070Domain d6iwtb1: 6iwt B:17-120 [367132]
    Other proteins in same PDB: d6iwta2, d6iwtb2
    automated match to d1kyze1
    complexed with peg

Details for d6iwtb1

PDB Entry: 6iwt (more details), 2.53 Å

PDB Description: crystal structure of methyltransferase comt-s in p. praeruptorum
PDB Compounds: (B:) Pmethyltransferase pCOMT-S

SCOPe Domain Sequences for d6iwtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iwtb1 a.4.5.0 (B:17-120) automated matches {Peucedanum praeruptorum [TaxId: 312531]}
eeeacmfamqlasasvlpmvlksaieldllesiakagpgayvspselaaklpssqpdtpv
mldrilrllasysvlkckvqdlpqggverlyalapvckfltkns

SCOPe Domain Coordinates for d6iwtb1:

Click to download the PDB-style file with coordinates for d6iwtb1.
(The format of our PDB-style files is described here.)

Timeline for d6iwtb1:

  • d6iwtb1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-04

View in 3D
Domains from same chain:
(mouse over for more information)
d6iwtb2