Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries) |
Domain d6cw9a1: 6cw9 A:6-185 [367019] Other proteins in same PDB: d6cw9a2, d6cw9b_, d6cw9c1, d6cw9c2, d6cw9d1, d6cw9d2 automated match to d3gmoa1 complexed with 7lm, fuc, nag, plm |
PDB Entry: 6cw9 (more details), 2 Å
SCOPe Domain Sequences for d6cw9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cw9a1 d.19.1.1 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d6cw9a1: