SCOPe 2.07: Domain d6cw9a1: 6cw9 A:6-185

Lineage for d6cw9a1 (6cw9 A:6-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries)

8. Domain d6cw9a1: 6cw9 A:6-185 [367019]
   Other proteins in same PDB: d6cw9a2, d6cw9b_, d6cw9c1, d6cw9c2, d6cw9d1, d6cw9d2
   automated match to d3gmoa1
   complexed with 7lm, fuc, nag, plm

Details for d6cw9a1

PDB Entry: 6cw9, 2 Å

PDB Description: structure of alpha-gc[8,16p] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cw9a1:

Sequence; same for both SEQRES and ATOM records:

>d6cw9a1 d.19.1.1 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6cw9a1:

• d6cw9a1 is new in SCOPe 2.07-stable
  
• d6cw9a1 appears in the current release, SCOPe 2.08