Lineage for d6cw9a1 (6cw9 A:6-185)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2507461Protein automated matches [191280] (4 species)
    not a true protein
  7. 2507517Species Mouse (Mus musculus) [TaxId:10090] [225821] (8 PDB entries)
  8. 3066957Domain d6cw9a1: 6cw9 A:6-185 [367019]
    Other proteins in same PDB: d6cw9a2, d6cw9b_, d6cw9c1, d6cw9c2, d6cw9d1, d6cw9d2
    automated match to d3gmoa1
    complexed with 7lm, fuc, nag, plm

Details for d6cw9a1

PDB Entry: 6cw9 (more details), 2 Å

PDB Description: structure of alpha-gc[8,16p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cw9a1 d.19.1.1 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6cw9a1:

Click to download the PDB-style file with coordinates for d6cw9a1.
(The format of our PDB-style files is described here.)

Timeline for d6cw9a1:

  • d6cw9a1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-04