Lineage for d6cwbc2 (6cwb C:116-204)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (554 PDB entries)
  8. 3066954Domain d6cwbc2: 6cwb C:116-204 [367016]
    Other proteins in same PDB: d6cwba1, d6cwba2, d6cwbb_, d6cwbc1, d6cwbd1, d6cwbd2
    automated match to d2pyfa2
    complexed with fjj, fuc, na, nag, plm

Details for d6cwbc2

PDB Entry: 6cwb (more details), 2.85 Å

PDB Description: structure of alpha-gsa[8,4p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (C:) Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18

SCOPe Domain Sequences for d6cwbc2:

Sequence, based on SEQRES records: (download)

>d6cwbc2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d6cwbc2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6cwbc2:

Click to download the PDB-style file with coordinates for d6cwbc2.
(The format of our PDB-style files is described here.)

Timeline for d6cwbc2:

  • d6cwbc2 appears in periodic updates to SCOPe 2.07 starting on 2019-04-04