Lineage for d6cvaa_ (6cva A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915733Species Neisseria meningitidis [TaxId:487] [232610] (4 PDB entries)
  8. 2915740Domain d6cvaa_: 6cva A: [367007]
    automated match to d3ir1b_

Details for d6cvaa_

PDB Entry: 6cva (more details), 1.56 Å

PDB Description: crystal structure of the n. meningitides methionine-binding protein in its substrate-free conformation
PDB Compounds: (A:) Lipoprotein

SCOPe Domain Sequences for d6cvaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvaa_ c.94.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 487]}
eivfgttvgdfgdmvkeqiqaelekkgytvklveftdyvrpnlalaegeldinvfqhkpy
lddfkkehnlditevfqvptaplglypgklksleevkdgstvsapndpsnfarvlvmlde
lgwiklkdginpltaskadiaenlknikiveleaaqlprsradvdfavvngnyaissgmk
ltealfqepsfayvawsavktadkdsqwlkdvteaynsdafkayahkrfegykspaawne
g

SCOPe Domain Coordinates for d6cvaa_:

Click to download the PDB-style file with coordinates for d6cvaa_.
(The format of our PDB-style files is described here.)

Timeline for d6cvaa_: