Lineage for d6a72b_ (6a72 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2954018Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2954019Protein automated matches [191063] (9 species)
    not a true protein
  7. 2954025Species Human (Homo sapiens) [TaxId:9606] [254969] (13 PDB entries)
  8. 2954029Domain d6a72b_: 6a72 B: [367002]
    automated match to d2gcfa_
    complexed with 9ux, ca

Details for d6a72b_

PDB Entry: 6a72 (more details), 2.1 Å

PDB Description: copper transporter protein
PDB Compounds: (B:) ATP7B protein

SCOPe Domain Sequences for d6a72b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a72b_ d.58.17.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcsttliaiagmtcascvhsiegmisqlegvqqisvslaegtatvlynpavispeelraa
iedmgfeasvvs

SCOPe Domain Coordinates for d6a72b_:

Click to download the PDB-style file with coordinates for d6a72b_.
(The format of our PDB-style files is described here.)

Timeline for d6a72b_: