SCOPe 2.08: Domain d6q6la2: 6q6l A:78-431

Lineage for d6q6la2 (6q6l A:78-431)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Glucosylceramidase, catalytic domain [89473] (1 species)
   acid-beta-glucosidase; glycosyl hydrolase family 30; contains additional beta-domain similar to one found in alpha amylases

7. Species Human (Homo sapiens) [TaxId:9606] [89474] (23 PDB entries)

8. Domain d6q6la2: 6q6l A:78-431 [366940]
   Other proteins in same PDB: d6q6la1, d6q6lb1
   automated match to d1ogsa2
   complexed with act, nag, rjr, so4

Details for d6q6la2

PDB Entry: 6q6l, 1.81 Å

PDB Description: crystal structure of recombinant human beta-glucocerebrosidase in complex with adamantyl-cyclophellitol inhibitor (me656)

PDB Compounds: (A:) glucosylceramidase

SCOPe Domain Sequences for d6q6la2:

Sequence; same for both SEQRES and ATOM records:

>d6q6la2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vkgfggamtdaaalnilalsppaqnlllksyfseegigyniirvpmascdfsirtytyad
tpddfqlhnfslpeedtklkiplihralqlaqrpvsllaspwtsptwlktngavngkgsl
kgqpgdiyhqtwaryfvkfldayaehklqfwavtaenepsagllsgypfqclgftpehqr
dfiardlgptlansthhnvrllmlddqrlllphwakvvltdpeaakyvhgiavhwyldfl
apakatlgethrlfpntmlfaseacvgskfweqsvrlgswdrgmqyshsiitnllyhvvg
wtdwnlalnpeggpnwvrnfvdspiivditkdtfykqpmfyhlghfskfipegs

Timeline for d6q6la2:

• d6q6la2 first appeared in SCOPe 2.07