Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class sigma GST [81362] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52875] (3 PDB entries) synonym: hematopoietic prostaglandin D synthase |
Domain d6n69a1: 6n69 A:2-75 [366928] Other proteins in same PDB: d6n69a2, d6n69b2 automated match to d1pd212 complexed with gsh, kdv |
PDB Entry: 6n69 (more details), 2 Å
SCOPe Domain Sequences for d6n69a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n69a1 c.47.1.5 (A:2-75) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]} pnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvlevegltl hqslaiaryltknt
Timeline for d6n69a1: