Lineage for d6n4ea2 (6n4e A:76-199)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2321894Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2322415Protein Class sigma GST [81351] (5 species)
  7. 2322428Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries)
    Uniprot O60760; synonym: hematopoietic prostaglandin D synthase
  8. 3066851Domain d6n4ea2: 6n4e A:76-199 [366913]
    Other proteins in same PDB: d6n4ea1
    automated match to d1pd211
    complexed with gsh, kcd

Details for d6n4ea2

PDB Entry: 6n4e (more details), 1.65 Å

PDB Description: hpgds complexed with a quinoline-3-carboxamide
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d6n4ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n4ea2 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d6n4ea2:

Click to download the PDB-style file with coordinates for d6n4ea2.
(The format of our PDB-style files is described here.)

Timeline for d6n4ea2:

  • d6n4ea2 appears in periodic updates to SCOPe 2.07 starting on 2019-03-28

View in 3D
Domains from same chain:
(mouse over for more information)
d6n4ea1