Lineage for d6n69b1 (6n69 B:1-75)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877135Protein Class sigma GST [81362] (5 species)
  7. 2877198Species Norway rat (Rattus norvegicus) [TaxId:10116] [52875] (3 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 2877202Domain d6n69b1: 6n69 B:1-75 [366901]
    Other proteins in same PDB: d6n69a2, d6n69b2
    automated match to d1pd212
    complexed with gsh, kdv

Details for d6n69b1

PDB Entry: 6n69 (more details), 2 Å

PDB Description: rat hpgds complexed with a quinoline
PDB Compounds: (B:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d6n69b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n69b1 c.47.1.5 (B:1-75) Class sigma GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
lhqslaiaryltknt

SCOPe Domain Coordinates for d6n69b1:

Click to download the PDB-style file with coordinates for d6n69b1.
(The format of our PDB-style files is described here.)

Timeline for d6n69b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6n69b2