SCOPe 2.08: Domain d6fzlb_: 6fzl B:

Lineage for d6fzlb_ (6fzl B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d6fzlb_: 6fzl B: [366812]
   automated match to d1bzea_
   mutant

Details for d6fzlb_

PDB Entry: 6fzl, 1.45 Å

PDB Description: crystal structure of human transthyretin double mutant k35t/t119m

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d6fzlb_:

Sequence, based on SEQRES records:

>d6fzlb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrtaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp

Sequence, based on observed residues (ATOM records):

>d6fzlb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrtaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsrrytiaallspysystmavvtnp

Timeline for d6fzlb_:

• d6fzlb_ first appeared in SCOPe 2.07