Lineage for d6ecra1 (6ecr A:2-126)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890462Family c.58.1.2: Tetrahydrofolate dehydrogenase/cyclohydrolase [53235] (2 proteins)
    automatically mapped to Pfam PF00763
  6. 2890463Protein Tetrahydrofolate dehydrogenase/cyclohydrolase [53236] (3 species)
    the two-domain organization is similar to that of aminoacid dehydrogenases, but both domains are truncated
  7. 2890469Species Human (Homo sapiens) [TaxId:9606] [53237] (7 PDB entries)
  8. 2890478Domain d6ecra1: 6ecr A:2-126 [366804]
    Other proteins in same PDB: d6ecra2, d6ecrb2
    automated match to d1a4ia2
    complexed with act, nap

Details for d6ecra1

PDB Entry: 6ecr (more details), 2.2 Å

PDB Description: the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp
PDB Compounds: (A:) methylenetetrahydrofolate dehydrogenase cyclohydrolase

SCOPe Domain Sequences for d6ecra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ecra1 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]}
apaeilngkeisaqirarlknqvtqlkeqvpgftprlailqvgnrddsnlyinvklkaae
eigikathiklprtttesevmkyitslnedstvhgflvqlpldsensinteevinaiape
kdvdg

SCOPe Domain Coordinates for d6ecra1:

Click to download the PDB-style file with coordinates for d6ecra1.
(The format of our PDB-style files is described here.)

Timeline for d6ecra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ecra2