SCOPe 2.08: Domain d6ehjb1: 6ehj B:115-295

Lineage for d6ehjb1 (6ehj B:115-295)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)

8. Domain d6ehjb1: 6ehj B:115-295 [366744]
   automated match to d3iu1a1
   complexed with asn, coa, gly, gol, lys, mya, myr, pro, ser

Details for d6ehjb1

PDB Entry: 6ehj, 2.1 Å

PDB Description: human n-myristoyltransferase (nmt1) with myristoyl-coa and peptide bound

PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d6ehjb1:

Sequence; same for both SEQRES and ATOM records:

>d6ehjb1 d.108.1.0 (B:115-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rsyqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelyt
llnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanih
iydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtc
r

Timeline for d6ehjb1:

• d6ehjb1 first appeared in SCOPe 2.07