SCOPe 2.08: Domain d6ct6b1: 6ct6 B:2-155

Lineage for d6ct6b1 (6ct6 B:2-155)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Eimeria maxima [TaxId:5804] [366729] (1 PDB entry)

8. Domain d6ct6b1: 6ct6 B:2-155 [366733]
   Other proteins in same PDB: d6ct6a2, d6ct6a3, d6ct6b2, d6ct6b3
   automated match to d3czma1
   complexed with glc, nai, oxm

Details for d6ct6b1

PDB Entry: 6ct6, 1.71 Å

PDB Description: crystal structure of lactate dehydrogenase from eimeria maxima with nadh and oxamate

PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d6ct6b1:

Sequence, based on SEQRES records:

>d6ct6b1 c.2.1.0 (B:2-155) automated matches {Eimeria maxima [TaxId: 5804]}
avfeqnkrpkialvgsgmiggtmaflcslkelgdvvlfdvvpnmpmgkamdlchnssvvd
ngitvygsnsyecltnadvviitagitkipgksdkewsrmdllpvnikimrevggaikky
cpnafiinitnpldvmvaavqeaanvpkhmicgm

Sequence, based on observed residues (ATOM records):

>d6ct6b1 c.2.1.0 (B:2-155) automated matches {Eimeria maxima [TaxId: 5804]}
avfeqnkrpkialvgsgmiggtmaflcslkelgdvvlfdvvpnmpmgkamdlchnssvvd
ngitvygsnsyecltnadvviitagitkipgkwsrmdllpvnikimrevggaikkycpna
fiinitnpldvmvaavqeaanvpkhmicgm

Timeline for d6ct6b1:

• d6ct6b1 first appeared in SCOPe 2.07