Lineage for d6ct6b1 (6ct6 B:2-155)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (259 species)
    not a true protein
  7. 3066667Species Eimeria maxima [TaxId:5804] [366729] (1 PDB entry)
  8. 3066671Domain d6ct6b1: 6ct6 B:2-155 [366733]
    Other proteins in same PDB: d6ct6b2, d6ct6b3
    automated match to d3czma1
    complexed with glc, nai, oxm

Details for d6ct6b1

PDB Entry: 6ct6 (more details), 1.71 Å

PDB Description: crystal structure of lactate dehydrogenase from eimeria maxima with nadh and oxamate
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d6ct6b1:

Sequence, based on SEQRES records: (download)

>d6ct6b1 c.2.1.0 (B:2-155) automated matches {Eimeria maxima [TaxId: 5804]}
avfeqnkrpkialvgsgmiggtmaflcslkelgdvvlfdvvpnmpmgkamdlchnssvvd
ngitvygsnsyecltnadvviitagitkipgksdkewsrmdllpvnikimrevggaikky
cpnafiinitnpldvmvaavqeaanvpkhmicgm

Sequence, based on observed residues (ATOM records): (download)

>d6ct6b1 c.2.1.0 (B:2-155) automated matches {Eimeria maxima [TaxId: 5804]}
avfeqnkrpkialvgsgmiggtmaflcslkelgdvvlfdvvpnmpmgkamdlchnssvvd
ngitvygsnsyecltnadvviitagitkipgkwsrmdllpvnikimrevggaikkycpna
fiinitnpldvmvaavqeaanvpkhmicgm

SCOPe Domain Coordinates for d6ct6b1:

Click to download the PDB-style file with coordinates for d6ct6b1.
(The format of our PDB-style files is described here.)

Timeline for d6ct6b1:

  • d6ct6b1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-28