Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) automatically mapped to Pfam PF02046 |
Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries) |
Domain d6nkng_: 6nkn G: [366720] Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nknd_, d6nkne_, d6nknf_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nkns_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_ automated match to d1v54g_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn |
PDB Entry: 6nkn (more details), 2.5 Å
SCOPe Domain Sequences for d6nkng_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nkng_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]} asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf swgdgnhtffhnprvnplptgyek
Timeline for d6nkng_:
View in 3D Domains from other chains: (mouse over for more information) d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nknd_, d6nkne_, d6nknf_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nknr_, d6nkns_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_ |