SCOPe 2.08: Domain d5zflb_: 5zfl B:

Lineage for d5zflb_ (5zfl B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries)

8. Domain d5zflb_: 5zfl B: [366705]
   automated match to d2blma_
   complexed with edo, epe; mutant

Details for d5zflb_

PDB Entry: 5zfl, 1.5 Å

PDB Description: crystal structure of beta-lactamase penp mutant e166y

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5zflb_:

Sequence; same for both SEQRES and ATOM records:

>d5zflb_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
kddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedln
qritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkel
rkigdevtnperfypelnevnpgetqdtstaralvtslrafaledklpsekrellidwmk
rnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdaky
ddkliaeatkvvmkaln

Timeline for d5zflb_:

• d5zflb_ first appeared in SCOPe 2.07