SCOPe 2.08: Domain d5y7jc2: 5y7j C:509-764

Lineage for d5y7jc2 (5y7j C:509-764)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller
   automatically mapped to Pfam PF00326

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82499] (58 PDB entries)
   Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487

8. Domain d5y7jc2: 5y7j C:509-764 [366658]
   Other proteins in same PDB: d5y7ja1, d5y7jb1, d5y7jc1, d5y7jd1
   automated match to d1rwqa2
   complexed with 8ol

Details for d5y7jc2

PDB Entry: 5y7j, 2.52 Å

PDB Description: crystal structure of human dpp4 in complex with inhibitor2

PDB Compounds: (C:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d5y7jc2:

Sequence; same for both SEQRES and ATOM records:

>d5y7jc2 c.69.1.24 (C:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

Timeline for d5y7jc2:

• d5y7jc2 first appeared in SCOPe 2.07