Lineage for d6nkno2 (6nkn O:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771133Domain d6nkno2: 6nkn O:91-227 [366630]
    Other proteins in same PDB: d6nkna_, d6nknb1, d6nknc_, d6nknd_, d6nkne_, d6nknf_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nknp_, d6nknq_, d6nknr_, d6nkns_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nkno2

PDB Entry: 6nkn (more details), 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6nkno2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nkno2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d6nkno2:

Click to download the PDB-style file with coordinates for d6nkno2.
(The format of our PDB-style files is described here.)

Timeline for d6nkno2: