SCOPe 2.08: Domain d6n7ub2: 6n7u B:109-214

Lineage for d6n7ub2 (6n7u B:109-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6n7ub2: 6n7u B:109-214 [366613]
   Other proteins in same PDB: d6n7ua_, d6n7ub1
   automated match to d1n0xl2

Details for d6n7ub2

PDB Entry: 6n7u, 2.03 Å

PDB Description: apo-bdbv223 fab

PDB Compounds: (B:) BDBV223 antibody light chain

SCOPe Domain Sequences for d6n7ub2:

Sequence; same for both SEQRES and ATOM records:

>d6n7ub2 b.1.1.2 (B:109-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrge

Timeline for d6n7ub2:

• d6n7ub2 first appeared in SCOPe 2.07