Lineage for d6ntza1 (6ntz A:31-291)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569346Species Escherichia coli [TaxId:562] [187306] (75 PDB entries)
  8. 3066547Domain d6ntza1: 6ntz A:31-291 [366609]
    Other proteins in same PDB: d6ntza2
    automated match to d1nj4a2
    complexed with mxr

Details for d6ntza1

PDB Entry: 6ntz (more details), 2.2 Å

PDB Description: crystal structure of e. coli pbp5-meropenem
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOPe Domain Sequences for d6ntza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ntza1 e.3.1.1 (A:31-291) automated matches {Escherichia coli [TaxId: 562]}
dlniktmipgvpqidaesyilidynsgkvlaeqnadvrrdpasltkmmtsyvigqamkag
kfketdlvtigndawatgnpvfkgsslmflkpgmqvpvsqlirginlqsgndacvamadf
aagsqdafvglmnsyvnalglknthfqtvhgldadgqyssardmaligqalirdvpneys
iykekeftfngirqlnrngllwdnslnvdgiktghtdkagynlvasategqmrlisavmg
grtfkgreaeskklltwgfrf

SCOPe Domain Coordinates for d6ntza1:

Click to download the PDB-style file with coordinates for d6ntza1.
(The format of our PDB-style files is described here.)

Timeline for d6ntza1:

  • d6ntza1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-21

View in 3D
Domains from same chain:
(mouse over for more information)
d6ntza2