Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (5 families) alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
Family d.110.6.0: automated matches [345975] (1 protein) not a true family |
Protein automated matches [346107] (2 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [365619] (6 PDB entries) |
Domain d6iorc1: 6ior C:30-267 [366562] Other proteins in same PDB: d6iora2, d6iorb2, d6iorc2, d6iord2 automated match to d5ltxb_ complexed with asn, ca |
PDB Entry: 6ior (more details), 2.5 Å
SCOPe Domain Sequences for d6iorc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6iorc1 d.110.6.0 (C:30-267) automated matches {Vibrio cholerae [TaxId: 666]} vreeieslvqdslmemvkgvkntiesdlaskkglaqstteilqldptnkafaksvlespn lkgsflaiglgyesdatvvenddgwepnadydprkrpwyvdakrerklvvtepyvdistk kiiisigtpvyqqsnfvgamfydveltqlaqlvnsvnlfdagylfittkdgvtiahpnae nngekfsqflpnvdlkegtqrieldgkyylvkfaqvpseswyigavvdesiafamvdd
Timeline for d6iorc1: