Lineage for d6dc7l1 (6dc7 L:1-107)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (175 PDB entries)
  8. 3066437Domain d6dc7l1: 6dc7 L:1-107 [366499]
    Other proteins in same PDB: d6dc7l2, d6dc7m2
    automated match to d2ok0l1

Details for d6dc7l1

PDB Entry: 6dc7 (more details), 1.9 Å

PDB Description: apo fab structure of mouse monoclonal antibody 8b2
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d6dc7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dc7l1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspelliykvsnrf
ygvpdrfsgsgsgtdftlkisrveaedlgvyycfqdshipytfgggtrleik

SCOPe Domain Coordinates for d6dc7l1:

Click to download the PDB-style file with coordinates for d6dc7l1.
(The format of our PDB-style files is described here.)

Timeline for d6dc7l1:

  • d6dc7l1 appears in periodic updates to SCOPe 2.07 starting on 2019-03-21

View in 3D
Domains from same chain:
(mouse over for more information)
d6dc7l2