Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [335395] (6 PDB entries) |
Domain d6fspf_: 6fsp F: [366407] automated match to d1vchb_ |
PDB Entry: 6fsp (more details), 2.7 Å
SCOPe Domain Sequences for d6fspf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fspf_ c.61.1.0 (F:) automated matches {Thermus thermophilus [TaxId: 274]} rtypveiagvrrelpivqvgpgvavallnllgdtelteaaaealakrlppevevlvtpev kavplahalsritgkpyvvarktekpyminpvsrqvlsittgkpqllvldgadiprvrgk kvaivddvvstgstlaglreliesvggevvavlavftegtprqdvvalghlp
Timeline for d6fspf_: