Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries) |
Domain d6coda1: 6cod A:1-258 [366345] Other proteins in same PDB: d6coda2, d6codb2 automated match to d3dqza_ complexed with cl, gol, hbx; mutant |
PDB Entry: 6cod (more details), 1.8 Å
SCOPe Domain Sequences for d6coda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6coda1 c.69.1.0 (A:1-258) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} merkhhfvlvhnachgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeysk plietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvld klmemfggwgdtefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsff tedlskkekfseegygsvqrvyvmssedkiipcdfirwmidnfnvskvyeidggdhmvml skpqklfdslsaiatdym
Timeline for d6coda1: