Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
Domain d6npua1: 6npu A:265-519 [366337] Other proteins in same PDB: d6npua2, d6npub2 automated match to d2f4ja_ complexed with 2pe, gol, kwv, so4, sti |
PDB Entry: 6npu (more details), 2.33 Å
SCOPe Domain Sequences for d6npua1:
Sequence, based on SEQRES records: (download)
>d6npua1 d.144.1.7 (A:265-519) automated matches {Human (Homo sapiens) [TaxId: 9606]} hklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkeikhpnlvqllgvc treppfyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdla arnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwaf gvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrps faeihqafetmfqes
>d6npua1 d.144.1.7 (A:265-519) automated matches {Human (Homo sapiens) [TaxId: 9606]} hklgggqygevyegvwkkysltvavktlkveeflkeaavmkeikhpnlvqllgvctrepp fyiitefmtygnlldylrecnrqevnavvllymatqissameylekknfihrdlaarncl vgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslaynkfsiksdvwafgvllw eiatygmspypgidlsqvyellekdyrmerpegcpekvyelmracwqwnpsdrpsfaeih qafetmfqes
Timeline for d6npua1: