Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Chlamydia trachomatis [TaxId:471473] [366249] (1 PDB entry) |
Domain d6o4nb1: 6o4n B:3-142 [366324] Other proteins in same PDB: d6o4na2, d6o4nb2 automated match to d4ywsa1 complexed with cl, edo, mg, mrd, po4 |
PDB Entry: 6o4n (more details), 1.8 Å
SCOPe Domain Sequences for d6o4nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o4nb1 d.54.1.0 (B:3-142) automated matches {Chlamydia trachomatis [TaxId: 471473]} dvvisdieareildsrgyptlcvkvitntgtfgeacvpsgastgikealelrdkdpkryq gkgvlqaisnvekvlvpalqgfsvfdqitadaimidadgtpnkeklganailgvslalak aaantlqrplyrylggsfsh
Timeline for d6o4nb1: