SCOPe 2.08: Domain d5zvla1: 5zvl A:51-151

Lineage for d5zvla1 (5zvl A:51-151)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Wheat (Triticum aestivum) [TaxId:4565] [366312] (1 PDB entry)

8. Domain d5zvla1: 5zvl A:51-151 [366320]
   Other proteins in same PDB: d5zvla2, d5zvlb2, d5zvlc2, d5zvld2, d5zvle2
   automated match to d2m80a_

Details for d5zvla1

PDB Entry: 5zvl, 2.96 Å

PDB Description: crystal structure of wheat glutarredoxin

PDB Compounds: (A:) glutaredoxin

SCOPe Domain Sequences for d5zvla1:

Sequence; same for both SEQRES and ATOM records:

>d5zvla1 c.47.1.0 (A:51-151) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
malakakeivasapvvvfsksycpfcvqvkklftqlgasfkaieldtesdgteiqsalae
wtgqrtvpnvfingkhiggcddtialnkggklvallteaga

Timeline for d5zvla1:

• d5zvla1 first appeared in SCOPe 2.07