Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Bacillus subtilis [TaxId:96241] [365239] (2 PDB entries) |
Domain d6nmxc1: 6nmx C:2-348 [366284] Other proteins in same PDB: d6nmxa2, d6nmxb2, d6nmxc2, d6nmxd2 automated match to d2zsja_ complexed with ljs |
PDB Entry: 6nmx (more details), 1.97 Å
SCOPe Domain Sequences for d6nmxc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmxc1 c.79.1.0 (C:2-348) automated matches {Bacillus subtilis [TaxId: 96241]} wkglihqykeflpvtdqtpaltlhegntplihlpklseqlgielhvktegvnptgsfkdr gmvmavakakeegndtimcastgntsaaaaayaaranmkciviipngkiafgklaqavmy gaeiiaidgnfddalkivrsicekspialvnsvnpyrlegqktaafevceqlgeapdvla ipvgnagnisaywkgfkeyhekngtslpkmrgfeaegsaaivrnevienpetiatairig npaswdkavkaaeesngkidevtddeilhayqliareegvfaepgscasiagvlkqvksg eipkgskvvavltgnglkdpntavdiseikpvtlptnedsileyvkg
Timeline for d6nmxc1: