SCOPe 2.08: Domain d6nmxc1: 6nmx C:2-348

Lineage for d6nmxc1 (6nmx C:2-348)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (38 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:96241] [365239] (2 PDB entries)

8. Domain d6nmxc1: 6nmx C:2-348 [366284]
   Other proteins in same PDB: d6nmxa2, d6nmxb2, d6nmxc2, d6nmxd2
   automated match to d2zsja_
   complexed with ljs

Details for d6nmxc1

PDB Entry: 6nmx, 1.97 Å

PDB Description: threonine synthase from bacillus subtilis atcc 6633 with plp and appa

PDB Compounds: (C:) threonine synthase

SCOPe Domain Sequences for d6nmxc1:

Sequence; same for both SEQRES and ATOM records:

>d6nmxc1 c.79.1.0 (C:2-348) automated matches {Bacillus subtilis [TaxId: 96241]}
wkglihqykeflpvtdqtpaltlhegntplihlpklseqlgielhvktegvnptgsfkdr
gmvmavakakeegndtimcastgntsaaaaayaaranmkciviipngkiafgklaqavmy
gaeiiaidgnfddalkivrsicekspialvnsvnpyrlegqktaafevceqlgeapdvla
ipvgnagnisaywkgfkeyhekngtslpkmrgfeaegsaaivrnevienpetiatairig
npaswdkavkaaeesngkidevtddeilhayqliareegvfaepgscasiagvlkqvksg
eipkgskvvavltgnglkdpntavdiseikpvtlptnedsileyvkg

Timeline for d6nmxc1:

• d6nmxc1 first appeared in SCOPe 2.07