Lineage for d6o1ke_ (6o1k E:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2380771Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2380772Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2380780Species Pseudomonas aeruginosa [TaxId:287] [141293] (12 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 3066172Domain d6o1ke_: 6o1k E: [366234]
    Other proteins in same PDB: d6o1ka1, d6o1ka2, d6o1kb1, d6o1kb2
    automated match to d3quia_
    protein/RNA complex

Details for d6o1ke_

PDB Entry: 6o1k (more details), 3.13 Å

PDB Description: architectural principles for hfq/crc-mediated regulation of gene expression. hfq-crc-amie 2:2:2 complex (core complex)
PDB Compounds: (E:) RNA-binding protein Hfq

SCOPe Domain Sequences for d6o1ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o1ke_ b.38.1.2 (E:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
srpvrlp

SCOPe Domain Coordinates for d6o1ke_:

Click to download the PDB-style file with coordinates for d6o1ke_.
(The format of our PDB-style files is described here.)

Timeline for d6o1ke_:

  • d6o1ke_ appears in periodic updates to SCOPe 2.07 starting on 2019-03-16