Lineage for d6nmpp_ (6nmp P:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632473Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
    core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest
  4. 2632474Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) (S)
    automatically mapped to Pfam PF00510
  5. 2632475Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
    function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel
  6. 2632488Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)
  7. 2632489Species Cow (Bos taurus) [TaxId:9913] [81444] (52 PDB entries)
  8. 2632589Domain d6nmpp_: 6nmp P: [366218]
    Other proteins in same PDB: d6nmpa_, d6nmpb1, d6nmpb2, d6nmpd_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpk_, d6nmpl_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpv_, d6nmpw_, d6nmpx_, d6nmpy_, d6nmpz_
    automated match to d1v54c_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d6nmpp_

PDB Entry: 6nmp (more details), 2.9 Å

PDB Description: sfx structure of oxidized cytochrome c oxidase at room temperature
PDB Compounds: (P:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d6nmpp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nmpp_ f.25.1.1 (P:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

SCOPe Domain Coordinates for d6nmpp_:

Click to download the PDB-style file with coordinates for d6nmpp_.
(The format of our PDB-style files is described here.)

Timeline for d6nmpp_: