| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) ![]() automatically mapped to Pfam PF02937 |
| Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
| Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
| Species Cow (Bos taurus) [TaxId:9913] [81412] (52 PDB entries) |
| Domain d6nmpv_: 6nmp V: [366215] Other proteins in same PDB: d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpd_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpj_, d6nmpk_, d6nmpl_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpw_, d6nmpx_, d6nmpy_, d6nmpz_ automated match to d1v54i_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 6nmp (more details), 2.9 Å
SCOPe Domain Sequences for d6nmpv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nmpv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak
Timeline for d6nmpv_:
View in 3DDomains from other chains: (mouse over for more information) d6nmpa_, d6nmpb1, d6nmpb2, d6nmpc_, d6nmpd_, d6nmpe_, d6nmpf_, d6nmpg_, d6nmph_, d6nmpi_, d6nmpj_, d6nmpk_, d6nmpl_, d6nmpm_, d6nmpn_, d6nmpo1, d6nmpo2, d6nmpp_, d6nmpq_, d6nmpr_, d6nmps_, d6nmpt_, d6nmpu_, d6nmpw_, d6nmpx_, d6nmpy_, d6nmpz_ |